PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g24310.1.p
Common NameBRADI_1g24310, LOC100829345
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 466aa    MW: 50009.8 Da    PI: 5.1465
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g24310.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS361.11.6e-110764412374
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                        +lLl+cAeav+ ++l +a+ lL ++ elasp g++ +R+aayf  AL ar+++s  + y+ l+  +++  +s ++++a+++++ +sP++kfs
  Bradi1g24310.1.p  76 LSLLLRCAEAVAMDSLPEARDLLHEIAELASPFGTSPERVAAYFGDALCARVLSSYLGAYSPLALASAQ--QSRRVASAFQAYNALSPLVKFS 166
                       689***************************************************999999988776665..6999999*************** PP

              GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLa.sRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvak. 184
                       h+taN+aIl+a++ge+rvH++D+di+qGlQWp L++ La sRp++p  slRiTg+g+    s e le+tg+rLa+fA +lg+pfef+++  k 
  Bradi1g24310.1.p 167 HFTANKAILQALDGEDRVHVVDLDIMQGLQWPGLFHMLAsSRPSKPLlSLRITGLGA----SLEVLEATGRRLADFAGSLGLPFEFRPIEGKi 255
                       ***************************************889977667*********....9**************************95554 PP

              GRAS 185 .rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl.eakl 275
                        +++d ++  L  ++gEa++V++++  h l+d ++s +     ++++++sl+Pk+v++veq++ h +++Fl rf+eal+yysalfd+l +   
  Bradi1g24310.1.p 256 gHVADTDVLLLGRDEGEATVVHWMH--HCLYDVTGSDAG----TVRVLRSLRPKLVTIVEQDLGH-GGDFLGRFVEALHYYSALFDALgDGAG 341
                       488888999999999*********9..888888888888....**********************.789*******************65555 PP

              GRAS 276 pres..eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrp 366
                       p+e+  ++r+ vEr+llg ei+n+va  g +r+ + + +e+W + l++aGF+pv+ls   a+qa+lll +++++gy++ ee+g+l lgWkd +
  Bradi1g24310.1.p 342 PEEEeaQQRHAVERQLLGAEIRNIVAVGGPKRTGEVR-VERWGDELRRAGFRPVSLSGGPAAQARLLLGMCPWKGYTLVEEDGCLKLGWKDLS 433
                       5555789************************998887.9****************************************************** PP

              GRAS 367 LvsvSaWr 374
                       L+++S+W+
  Bradi1g24310.1.p 434 LLTASSWE 441
                       *******5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098556.30349421IPR005202Transcription factor GRAS
PfamPF035145.4E-10876441IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0090610Biological Processbundle sheath cell fate specification
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 466 aa     Download sequence    Send to blast
MIQGVLSRAS AADAAAMKAK RVAPIPEDEE AAMVGARGKR LQLHSSGVQQ QQEAPAEEGK  60
VVVVEAAAET RGLRLLSLLL RCAEAVAMDS LPEARDLLHE IAELASPFGT SPERVAAYFG  120
DALCARVLSS YLGAYSPLAL ASAQQSRRVA SAFQAYNALS PLVKFSHFTA NKAILQALDG  180
EDRVHVVDLD IMQGLQWPGL FHMLASSRPS KPLLSLRITG LGASLEVLEA TGRRLADFAG  240
SLGLPFEFRP IEGKIGHVAD TDVLLLGRDE GEATVVHWMH HCLYDVTGSD AGTVRVLRSL  300
RPKLVTIVEQ DLGHGGDFLG RFVEALHYYS ALFDALGDGA GPEEEEAQQR HAVERQLLGA  360
EIRNIVAVGG PKRTGEVRVE RWGDELRRAG FRPVSLSGGP AAQARLLLGM CPWKGYTLVE  420
EDGCLKLGWK DLSLLTASSW EPTTTDGDEE DDLGAAARQE ECHGS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-44754404374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003560068.10.0PREDICTED: scarecrow-like protein 23
SwissprotQ9FHZ11e-162SCL23_ARATH; Scarecrow-like protein 23
TrEMBLI1GTB50.0I1GTB5_BRADI; Uncharacterized protein
STRINGBRADI1G24310.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137138122
Representative plantOGRP21831437
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41920.11e-145GRAS family protein